Gene ML1053 
in Mycobacterium leprae TN
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | PE FAMILY PROTEIN | 
| Comments | ML1053, len: 99 aa. Member of PE family protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:Q49943 (EMBL:U15180) (99 aa), Fasta scores: E(): 0, 100.0% identity in 99 aa overlap. Also highly similar to the whole or just the N-terminus of many Mycobacterium tuberculosis PE-family proteins e.g. Rv1195 O05297 (111 aa), fasta scores: E(): 5.8e-13 (48.913% identity in 92 aa overlap) and TR:P71664 (EMBL:Z80108) (576 aa), Fasta scores: E(): 3.2e-10, 44.6% identity in 92 aa overlap. Also similar to ML1183c a possible paralogue of M. tuberculosis Rv1195. | 
| Functional category | Pe/ppe | 
| Mutant | Check for mutants available at TARGET website  | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 1220377 | 1220676 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium leprae TN|ML1053|PE5
MPLFLNAEPQALTAAANTLEGLSAATVASNAAAAQLTTEIAPPAADDVSILLAHFFSGHGRQYQAHASQGATNHQDLIQSLLTSSSAYAGTETANHDSL
      
    Bibliography
    No article yet recorded