Gene ML1056 (esxL)
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Putative ESAT-6 like protein EsxL1 (ESAT-6 LIKE PROTEIN 4) |
Comments | ML1056, len: 95 aa. Probable esxL1, ESAT-6 like protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein Q49946|U15180 (95 aa), Fasta scores: E(): 0, (100.0% identity in 95 aa overlap). Also similar to several putative Esat-6 like proteins from M. tuberculosis e.g. O05300|ESXL_MYCTU ESAT-6 like protein esxL (94 aa), fasta scores: E(): 4.6e-24, (64.130% identity in 92 aa overlap). Identical to ML1180c a possible paralogue of M. tuberculosis esxL2. SEEMS TO BELONG TO THE ESAT6 FAMILY. |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1221790 | 1222077 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1056|esxL1 MGNINYQFGEIDAHGAAIRAQAAALETTHQAILATVRDAAEFWGGQGSTAHEMFIADLGRNFQMIYEQANSHGQKVQRASSSMADTDRSVSSAWS
Bibliography
No article yet recorded