Gene ML1056 (esxL)
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Putative ESAT-6 like protein EsxL1 (ESAT-6 LIKE PROTEIN 4) |
| Comments | ML1056, len: 95 aa. Probable esxL1, ESAT-6 like protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein Q49946|U15180 (95 aa), Fasta scores: E(): 0, (100.0% identity in 95 aa overlap). Also similar to several putative Esat-6 like proteins from M. tuberculosis e.g. O05300|ESXL_MYCTU ESAT-6 like protein esxL (94 aa), fasta scores: E(): 4.6e-24, (64.130% identity in 92 aa overlap). Identical to ML1180c a possible paralogue of M. tuberculosis esxL2. SEEMS TO BELONG TO THE ESAT6 FAMILY. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1221790 | 1222077 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1056|esxL1
MGNINYQFGEIDAHGAAIRAQAAALETTHQAILATVRDAAEFWGGQGSTAHEMFIADLGRNFQMIYEQANSHGQKVQRASSSMADTDRSVSSAWS
Bibliography
No article yet recorded