Gene ML1061 
in Mycobacterium leprae TN
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | conserved hypothetical protein | 
| Comments | ML1061, len: 187 aa. Conserved hypothetical protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:Q49952 (EMBL:U15180) (187 aa), Fasta scores: E(): 0, 100.0% identity in 187 aa overlap. Also highly similar to Mycobacterium tuberculosis TR:O05306 (EMBL:Z93777) (187 aa), Fasta scores: E(): 0, 72.4% identity in 174 aa overlap. | 
| Functional category | Conserved hypotheticals | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 1226445 | 1227008 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium leprae TN|ML1061|ML1061
MRSDRGKPNAWAICVFCAAGPMHPELLELAAELGEAIAERGWTLVWGGGRVSAMGAVASAAWTRGGRIVGVIPEMLQRREIADTYVGELIVTETMAERKQVLDDHADAFIVLPGGLGTLDELFEAWTAGYLGMHRKPIVMLDPWGHYEGLWAWLHGLIDSGYVSPVAMERLVVVDQVDAALEACMSV
      
    Bibliography
    No article yet recorded