Gene ML1061
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1061, len: 187 aa. Conserved hypothetical protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:Q49952 (EMBL:U15180) (187 aa), Fasta scores: E(): 0, 100.0% identity in 187 aa overlap. Also highly similar to Mycobacterium tuberculosis TR:O05306 (EMBL:Z93777) (187 aa), Fasta scores: E(): 0, 72.4% identity in 174 aa overlap. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1226445 | 1227008 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1061|ML1061
MRSDRGKPNAWAICVFCAAGPMHPELLELAAELGEAIAERGWTLVWGGGRVSAMGAVASAAWTRGGRIVGVIPEMLQRREIADTYVGELIVTETMAERKQVLDDHADAFIVLPGGLGTLDELFEAWTAGYLGMHRKPIVMLDPWGHYEGLWAWLHGLIDSGYVSPVAMERLVVVDQVDAALEACMSV
Bibliography
No article yet recorded