Gene ML1063
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE DIHYDROPTEROATE SYNTHASE 2 FOLP2 (DHPS 2) (Dihydropteroate pyrophosphorylase 2) |
| Comments | ML1063, len: 291 aa. Probable folP2, dihydropteroate synthase 2 (EC 2.5.1.15). Identical to the previously sequenced Mycobacterium leprae dihydropteroate synthase (EC 2.5.1.15) SWDHPS_MYCLE:. Also highly similar to dihydropteroate synthases from Mycobacterium tuberculosis Rv1207 SW:DHP2_MYCTU (O05308) (318 aa), Fasta scores: E(): 0, 86.2% identity in 290 aa overlap and Escherichia coli SW:DHPS_ECOLI (P26282) (282 aa), Fasta scores: E(): 7.2e-24, 34.4% identity in 270 aa overlap. Also similar to ML0224 from M. leprae. Contains Pfam match to entry PF00809 DHPS, Dihydropteroate synthase. Contains PS00793 Dihydropteroate synthase signature 2. Contains PS00792 Dihydropteroate synthase signature 1. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1228779 | 1229654 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1063|folP2
VQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAEGADVIDVGGVKAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRAEVARLACTAGADLINDSWGGADPAMHEVAAELGAGLVCSHTGGALPRTRPFRVSYGTTTRGVVDDVIRQVTAAAERAVAAGVTRDSVLVDPTHDFGKNTFHGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTERLEGTLAATALAAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
Bibliography
No article yet recorded