Gene ML1065
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1065, len: 114 aa. Conserved hypothetical protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:Q49955. Also highly similar to Mycobacterium tuberculosis hypothetical protein Rv1209 TR:O05310 (EMBL:Z93777) (122 aa), Fasta scores: E(): 1.3e-27, 78.6% identity in 112 aa overlap. Note the N-terminus of this protein is rich in the amino acid valine producing a possible membrane spanning hydrophobic domain. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1230647 | 1230991 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1065|ML1065
VALVLLYLVVLVLVAIVLFGAASLLFGRGERLPPLPRGTTATVLPAHGVTGADVDAVKFTQVLRGYKPSEVDWVLDRLGRELEALRGQLAAIADAEADADVSNVPSGDDGQDVT
Bibliography
No article yet recorded