Gene ML1067
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1067, len: 75 aa. Conserved hypothetical protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:Q49958 (EMBL:U15180) (75 aa), Fasta scores: E(): 1.9e-29, 100.0% identity in 75 aa overlap. Also highly similar to Mycobacterium tuberculosis hypothetical protein Rv1211 TR:O05312 (EMBL:Z93777) (75 aa), Fasta scores: E(): 1.6e-26, 90.7% identity in 75 aa overlap. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1231780 | 1232007 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1067|ML1067
MLGAEWVREGGPARVWREHTMAAMKPRTGDGPLEATKEGRGIVMRVPLEGGGRLVVELTPDEAAALSDELKGVTS
Bibliography
No article yet recorded