Gene ML1138
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible integral membrane protein |
| Comments | ML1138, len: 153 aa. Possible integral membrane protein. Identical to the previously sequenced Mycobacterium leprae SW:YD03_MYCLE (P53431) (153 aa), Fasta scores: E(): 0, 99.3% identity in 153 aa overlap. Also highly similar to Mycobacterium tuberculosis hypothetical protein Rv1303 SW:YD03_MYCTU (Q10619) (161 aa), Fasta scores: E(): 0, 69.8% identity in 149 aa overlap. Contains possible membrane spanning hydrophobic domains. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1329965 | 1330426 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1138|ML1138
VTTPAQDAPLVLPAVAFRPVRLFIINIVLTGLAMLAAGLSGHLMVGVFFGIGLLLGLLNALLVRCSVESITAQGHPLKRSMALNSASRLAIITVFGLIIAYAFPLAGLGVVFGLALFQVLLVLSTMLPVWRKFRFGEADGGVLKGSEGEEQQR
Bibliography
No article yet recorded