Gene ML1180c (esxL)
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Putative ESAT-6 like protein EsxL2 (ESAT-6 LIKE PROTEIN 4) |
Comments | ML1180c, len: 95 aa. Probable esxL2, ESAT-6 like protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein Q49946|EMBL:U15180 (95 aa), Fasta scores: E(): 0, (100.0% identity in 95 aa overlap). Identical to ML1056 a possible orthologue of M. tuberculosis esxL1. Also similar to several putative Esat-6 like proteins from M. tuberculosis e.g. O05300|ESXL_MYCTU ESAT-6 like protein esxL (94 aa), Fasta scores: E(): 7.7e-24, (64.130% identity in 92 aa overlap). SEEMS TO BELONG TO THE ESAT6 FAMILY. |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1380303 | 1380590 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1180c|esxL2 MGNINYQFGEIDAHGAAIRAQAAALETTHQAILATVRDAAEFWGGQGSTAHEMFIADLGRNFQMIYEQANSHGQKVQRASSSMADTDRSVSSAWS
Bibliography
No article yet recorded