Gene ML1181c (esxK)
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Putative ESAT-6 like protein EsxK2 |
| Comments | ML1181c, len: 100 aa. Putative esxK2, ESAT-6 like protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein Q49945|U15180 (100 aa), Fasta scores: E(): 0, (100.0% identity in 100 aa overlap). Identical to ML1055 a possible orthologue of M. tuberculosis esxK. Also similar to several putative Esat-6 like proteins from M. tuberculosis e.g. O05299|ESXK_MYCTU ESAT-6 like protein esxK (98 aa), fasta scores: E(): 1.2e-19, (58.333% identity in 96 aa overlap). SEEMS TO BELONG TO THE ESAT6 FAMILY. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1380642 | 1380944 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1181c|esxK2
MTAAHFMTDPQAMRDMARKFDMHAQNVRDESHKMFMSSMDIAGAGWSGTAQLTSHDTMGQINQAFRHIVTLLQDVRDQLGTAADRYEHQEENSRKILSGS
Bibliography
No article yet recorded