Gene ML1214c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible invasion protein (NLP/P60 family protein) |
| Comments | ML1214c, len: 212 aa. Possible inv protein, probably exported as has QQAPV repeats at C-terminus. Previously sequenced Mycobacterium leprae TR:Q49634 (EMBL:U00010) (246 aa), Fasta scores: E(): 0, 100.0% identity in 206 aa overlap. This predicted product of this CDS is similar to several including a portion of Listeria monocytogenes SW:P60_LISMO (P21171) (484 aa), Fasta scores: E(): 0.0013, 29.7% identity in 148 aa overlap invasion-associated protein P60 and several other proteins of undefined function e.g. Mycobacterium tuberculosis Rv1566c TR:O06624 (EMBL:Z95586) (230 aa), Fasta scores: E(): 0, 69.4% identity in 209 aa overlap. Contains a possible N-terminal signal sequence. Contains Pfam match to entry PF00877 NLPC_P60, NLP/P60 family. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1437013 | 1437651 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1214c|ML1214c
MNRIYTFVTGLAMLVTSILTCSLAYADSGTRTADYQQTIDTVVQRALAQRGVPFSWAGGGVSGPTRGTGTGSNTVGFDASGLIQYAYAGAGLKLPRSSGEMYKVGQKVLPRHARRGDLIFYGPEGTESVTLYLGDEKMVEVGEVVQVSPVRSNGMAPYLVRVLGTQPTSVPQAPLQQVPTLPAPQQTPTHRAPLQHMPLQVPVRPVPVSTAR
Bibliography
No article yet recorded