Gene ML1218
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable dethiobiotin synthetase BioD |
| Comments | ML1218, len: 226 aa. Probable bioD, dethiobiotin synthetase (EC 6.3.3.3). Identical to the previously sequenced Mycobacterium leprae dethiobiotin synthetase (EC 6.3.3.3) SW:BIOD_MYCLE (P45486) (223 aa), Fasta scores: E(): 0, 99.6% identity in 223 aa overlap. Also highly similar to several others involved in biotin biosynthesis e.g. Mycobacterium bovis SW:BIOD_MYCBO (O52587) (226 aa), Fasta scores: E(): 0, 74.2% identity in 225 aa overlap and Mycobacterium tuberculosis Rv1570 SW:BIOD_MYCTU (O06620) (226 aa), Fasta scores: E(): 0, 74.2% identity in 225 aa overlap. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1441071 | 1441751 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1218|bioD
LTVVVVTGTDTGVGKTVACAALACHARQAGIEVAVCKPVQTGTQIGDDDLAEVARLSGVTELTGLVRYPQPLAPAAAAEHAGMALPTREQLLELIAGLDRPGRLILVEGAGGLLVELADASATLRDLAVELGALALVTVSVELGTLNHTALTLEALTTRGVACAGLVIGSWTGRPGAVQISNRSALARLAPMRATLPAGAGSMDATDFAAMSAAAFDRDWVTTLVH
Bibliography
No article yet recorded