Gene ML1221
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML1221, len: 80 aa. Conserved hypothetical protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:Q49616 (EMBL:U00010) (80 aa), Fasta scores: E(): 0, 98.8% identity in 80 aa overlap. Also highly similar to Mycobacterium tuberculosis hypothetical protein Rv1590 TR:O06600 (EMBL:Z95586) (79 aa), Fasta scores: E(): 3.4e-21, 67.1% identity in 73 aa overlap. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1443568 | 1443810 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1221|ML1221
VVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGRRMVVQVRPDGWRAKCSRHGQVDSVDMEAKR
Bibliography
No article yet recorded