Gene ML1232c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1232c, len: 358 aa. Conserved hypothetical protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:Q49633 (EMBL:U00010) (391 aa), Fasta scores: E(): 0, 100.0% identity in 358 aa overlap. Also highly similar to Mycobacterium tuberculosis Possible exported protein Rv1184c TR:O50440 (EMBL:AL010186) (359 aa), Fasta scores: E(): 0, 62.7% identity in 338 aa overlap. Contains PS00017 ATP/GTP-binding site motif A (P-loop). |
| Functional category | Conserved hypotheticals, Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1465615 | 1466691 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1232c|ML1232c
MKRLLATTLAALTVGTVSGFGSTVASSEPGEPWLPPSPVPVRENSPAKIVYALGGARPPTFDWDYYTIRAGDEFFPDVNRKLIDYPARAPFRYVPTFLVPGPRDEVTIGEAIAVATKNLNQAIHRGTEPAAVVGLSQGSLALDTEQEQLATDPTAPPPDQLTFNTFGDPSGYHGFGKSVLASIFRPGDYIPLIDYTMPQRMDSQYDSNRVVAAYDGLSEFPDRADNLLAQLNCFAGGAISHTPSGFFNPEDVPPQNIRTTVNSRGAKTTTYLIPVNHLPLTLPLRYLGWSDALVDQIDAVLQPKIDAAYAYNDNPLNKPISVDPVNGMDPIAGIDAELRDSILNVFAQLRSILPPPPG
Bibliography
No article yet recorded