Gene ML1259
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable imidazole glycerol-phosphate dehydratase HisB |
| Comments | ML1259, len: 210 aa. Probable hisB, imidazole glycerol-phosphate dehydratase (EC 4.2.1.19). Highly similar to many imidazoleglycerol-phosphate dehydratases involved in histidine biosynthesis e.g. from Mycobacterium tuberculosis Rv1601 SW:HIS7_MYCTU (O06590) (210 aa), Fasta scores: E(): 0, 84.8% identity in 210 aa overlap and Streptomyces coelicolor SW:HIS7_STRCO (P16247) (197 aa), Fasta scores: E(): 0, 56.4% identity in 202 aa overlap. Contains 2 Pfam matches to entry PF00475 IGPD, Imidazoleglycerol-phosphate dehydratase. Contains PS00955 Imidazoleglycerol-phosphate dehydratase signature 2. Contains PS00954 Imidazoleglycerol-phosphate dehydratase signature 1. Belongs to the imidazoleglycerol-phosphate dehydratase family. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1504776 | 1505408 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1259|hisB
VTNTEVGKTTRRARIERRTSESDIVVELDLDGTGQVHIDTGVSFYDHMLTALGSHASFDLTVCTKGDVEIEAHHTIEDTAIALGQAFGQALGNKKGIRRFGDAFIPMDETLVHAVVDVSGRPYCVHTGEPDHLQHNIISGSSVPYSTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALSEAVKFDPRFSGVPSTKGVL
Bibliography
No article yet recorded
