Gene ML1260
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Histidine biosynthesis (fifth step). IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The hisH subunit provides the glutamine amidotransferase activity that produces the ammonia necessary to hisF for the synthesis of IGP and AICAR. [CATALYTIC ACTIVITY: 5-[(5-phospho-1-deoxyribulos-1-ylamino)methylideneamino]-1-(5-phosphoribosyl)imidazole-4-carboxamide + L-glutamine = imidazole-glycerol phosphate + 5-aminoimidazol-4-carboxamide ribonucleotide + L-glutamate + H2O]. |
| Product | Imidazole glycerol phosphate synthase subunit HisH (IGP synthase glutamine amidotransferase subunit) (IGP synthase subunit hisH) (ImGP synthase subunit hisH) |
| Comments | ML1260, len: 206 aa. Probable hisH, Imidazole glycerol phosphate synthase subunit (EC 2.4.2.-). Highly similar to many amidotransferases involved in histidine biosynthesis including: Mycobacterium tuberculosis HisH (Rv1602) TR:O06589 (EMBL:Z95586) (206 aa), Fasta scores: E(): 0, 79.4% identity in 204 aa overlap and Escherichia coli SW:HIS5_ECOLI (P10375) (196 aa), Fasta scores: E(): 3.9e-20, 41.5% identity in 205 aa overlap. Contains Pfam match to entry PF00117 GATase, Glutamine amidotransferase class-I. Contains PS00442 Glutamine amidotransferases class-I active site. BELONGS TO THE HISH FAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1505405 | 1506025 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1260|hisH
VRSKSVVVLDYGSGNLWSVQRALQRVGAAVEVTADSAAGAAADGLLVPGVGAFEACMAGLRKIAGERTIAERIVAGRPVLGVCVGMQILFARGVEFGVETTGCRQWPGVVTRLDAPVVPHMGWNVVDSASGSALFKGLDAGVRFYFVHSYAAQRWEGSSKALLTWATHQVPFLAAVEEGPLVATQFHPEKSGDAGATLLSNWLGEL
Bibliography
No article yet recorded
