Gene ML1286
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable two-component system transcriptional regulator |
| Comments | ML1286, len: 205 aa. Probable two-component system transcriptional regulator. Similar to many proposed two-component response regulators including: Streptomyces coelicolor TR:Q9S2J0 (EMBL:AL109732) (218 aa), Fasta scores: E(): 0, 65.3% identity in 202 aa overlap and Azotobacter vinelandii TR:Q44531 (EMBL:X83602) (192 aa), Fasta scores: E(): 4.5e-11, 30.1% identity in 186 aa overlap. Also highly similar to Mycobacterium tuberculosis probable two-component response system transcriptional regulator Rv1626 TR:O06143 (EMBL:Z95554) (205 aa), Fasta scores: E(): 0, 90.7% identity in 205 aa overlap. Contains Pfam match to entry PF00072 response_reg, Response regulator receiver domain. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1531870 | 1532487 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1286|ML1286
MTGPTTDADAATPHRVLIAEDEALIRLDLAEMLRDEGYDIVGEAADGQEAVELAERHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFTISDLIPAIALAMSRFSELTALEREVATLADRLETRKLVERAKGLLQVKQGMTEPEAFKWIQRAAMDRRTTMKRVAEVVLETLDTPKDT
Bibliography
No article yet recorded