Gene ML1289 (TB18.6)
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN TB18.6 HOMOLOG |
| Comments | ML1289, len: 176 aa. Conserved hypothetical protein. Similar to many proteins of undefined function including: Mycobacterium tuberculosis Rv2140c SW:YL40_MYCTU (O06235) (176 aa), Fasta scores: E(): 0, 86.3% identity in 175 aa overlap and Escherichia coli SW:YBCL_ECOLI (P77368) (183 aa), Fasta scores: E(): 1.1e-21, 45.3% identity in 161 aa overlap. Note this CDS contains a strong Pfam hit to the Eukaryotic phosphatidylethanolamine-binding protein motif. In Eukaryotes this motif is associated with the binding of hydrophobic ligands and nucleotides. Contains Pfam match to entry PF01161 PBP, Phosphatidylethanolamine-binding protein. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1537588 | 1538118 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1289|ML1289
MSLPPDPYAALPKLPSFHLTSDSITDGQPLATPQISGIMGAGGADVSPQLSWSGFPTETCSFAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGVGNDGELPAGALTLINDAGMRRYIGAAPPPGHGVHRYYVAVHAVRVQKLNLSEDASPAFLGFNLFQHAIARAVIHGTYEQH
Bibliography
No article yet recorded