Gene ML1297
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Possible conserved transmembrane protein |
Comments | ML1297, len: 282 aa. Possible conserved transmembrane protein. Similar to Mycobacterium tuberculosis Rv2136c TR:O06239 (EMBL:Z95388) (276 aa), Fasta scores: E(): 0, 82.6% identity in 276 aa overlap. Also similar to several proposed undecaprenol kinases or bacitracin resistance proteins including: Escherichia coli SW:BACA_ECOLI (P31054) (273 aa), Fasta scores: E(): 3.7e-23, 34.0% identity in 265 aa overlap and Contains multiple possible membrane spanning hydrophobic domains. |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1546120 | 1546968 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1297|ML1297 VTAVSAMSWWQVIVLAVVQGLTEFLPVSSSGHLAIVSRILFTGDAGASFTAVSQLGTEVAVLVYFGRDIVRILHAWCRGLTVTLHRTADYWLGWYVIIGTIPICILGLVCKDEIRSGIRPLWVVATALVAFSGVIAFAEYVGRQNRCIEQLNWRDALVVGVAQTLALIPGVSRSGSTISAGLFLGLDRELAARFGFLLAIPAVFASGLFSIPDAFHPITEGMSATGAQLLVATVIAFVVGLVAVSWLLRFLVQHNLYWFVGYRIVVGVGVLILLAVKTVAAT
Bibliography
No article yet recorded