Gene ML1306c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1306c, len: 274 aa. Conserved hypothetical protein. Similar to several proteins of unknown function including: Mycobacterium tuberculosis Rv2125 TR:O33260 (EMBL:Z97559) (292 aa), Fasta scores: E(): 0, 85.0% identity in 274 aa overlap and Streptomyces coelicolor TR:Q9S2K6 (EMBL:AL109732) (312 aa), Fasta scores: E(): 1.6e-07, 23.4% identity in 278 aa overlap. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1555823 | 1556647 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1306c|ML1306c
VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQVDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIADRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPTGIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDVEVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALGKIDGDALAAEFERYLRRRRPGFGR
Bibliography
No article yet recorded