Gene ML1314c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1314c, len: 97 aa. Conserved hypothetical protein. Highly similar to several proteins of unknown function e.g. Mycobacterium tuberculosis Rv2117 TR:O33252 (EMBL:Z97559) (97 aa), Fasta scores: E(): 0, 85.6% identity in 97 aa overlap. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1567074 | 1567367 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1314c|ML1314c
MWIGWLEFDVLLGDVHSLKQKRSLIRPVLAELQHKFSVSAAETGSHDLYRRAGIGVAMVSSDRSHTVDVLDASERLVAAHPEFELLHVRRGLHHSDD
Bibliography
No article yet recorded