Gene ML1315c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved lipoprotein LppK |
| Comments | ML1315c, len: 194 aa. Probable lppK, conserved lipoprotein. Highly similar to Mycobacterium tuberculosis putative lipoprotein LppK (Rv2116) SW:LPPK_MYCTU (O33251) (189 aa), Fasta scores: E(): 1.4e-29, 51.6% identity in 188 aa overlap. Contains a possible N-terminal signal sequence and an appropriately positioned Prokaryotic membrane lipoprotein lipid attachment site. Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1567376 | 1567960 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1315c|lppK
VSRWTHRTFFIALSAIVTTAGFGSSGCAHGNSSTSESAVPSTFPGISSSITAPPATGLPAPEVLTNVLSRLADPNIPGIDKLPLIESATPDSAVTLDKFSNALRDNGYLPMTFTANNIAWSNKNPSDVLATISVNIAQTNNSVFSFPMEFTPFPPPQQSWQLSKRTADMLLEFGNSSGLTNPAPIKAPTPTPSH
Bibliography
No article yet recorded