Gene ML1322
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | proteasome (beta subunit) PrcB |
| Comments | ML1322, len: 291 aa. Probable prcB, proteasome beta-type subunit 2 (EC 3.4.25.1). Highly similar to many proposed 20S proteasome beta subunits including: Methanococcus jannaschii SW:PRCB_METJA (Q58634) (224 aa), Fasta scores: E(): 0.00015, 29.0% identity in 183 aa overlap, Rhodococcus sp. TR:Q53079 (EMBL:U26421) (294 aa), Fasta scores: E(): 0, 63.5% identity in 266 aa overlap and Mycobacterium tuberculosis Rv2110c TR:O33245 (EMBL:Z97559) (291 aa), Fasta scores: E(): 0, 81.0% identity in 290 aa overlap. Contains Pfam match to entry PF00227 proteasome, Proteasome A-type and B-type. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1575685 | 1576560 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1322|prcB
VTRSFPDRLPTNLAFPGISVINQSSFVDLLRRQAPELLPVSLGGGQSGGGQQLSHGTTIVVLKYPGGVVIAGDRRSTQGNMIAGRDVRKVYITDDYTATGIAGIAAVAVEFARLYAVELEHYEKLEGVPLTFAGKVNRLAIMVRSNLTAAMQGLLALPLLAGYDIHAPDPQSAGRIVSFDAAGGWNIEEEGYQSVGSGSIFAKSSIKKLYSQVSDADSALRVAIEALYDAADDDSATGGPDLVRGIYPTAVTIGAEGAAEVTESRIAELAREIIESRSRAYTLGSFGGSEK
Bibliography
No article yet recorded