Gene ML1334
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible conserved membrane protein |
| Comments | ML1334, len: 272 aa. Possible conserved membrane protein. Highly similar to several e.g. Mycobacterium tuberculosis hypothetical protein Rv2091c SW:YK91_MYCTU (Q10700) (244 aa), Fasta scores: E(): 0, 62.9% identity in 272 aa overlap. Note the product of this CDS contains a 7xPGQYG(P/S) repeat region similar to several bacterial protein calcium binding domains. Contains a possible membrane spanning hydrophobic domain. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1587326 | 1588144 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1334|ML1334
MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPAYASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQSGSPGQYGSPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYSQQFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDVNKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDGMQKRVTVTFQDDKGTYEVGRPQ
Bibliography
No article yet recorded