Gene ML1334 
in Mycobacterium leprae TN
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | possible conserved membrane protein | 
| Comments | ML1334, len: 272 aa. Possible conserved membrane protein. Highly similar to several e.g. Mycobacterium tuberculosis hypothetical protein Rv2091c SW:YK91_MYCTU (Q10700) (244 aa), Fasta scores: E(): 0, 62.9% identity in 272 aa overlap. Note the product of this CDS contains a 7xPGQYG(P/S) repeat region similar to several bacterial protein calcium binding domains. Contains a possible membrane spanning hydrophobic domain. | 
| Functional category | Cell wall and cell processes | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 1587326 | 1588144 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium leprae TN|ML1334|ML1334
MSEPQGSDPGKQWQSPGEGVENHSSDQPTQAASPWQQQPSTQDSTWHPPAYASPECYNYPQLTEPVYPHQYPSATPGYGQPGYFGAQFSQCGIPGQYPQSGSPGQYGSPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYGPPGQYSQQFQPYEQPGTKGFVALIGSIAGVIGVLIFAAILVTGFLWPAWLVTTKLDVNKAQASVQQVLTDETNGYGAKNVKDVKCNNGADPTVKKGDTFDCSVSIDGMQKRVTVTFQDDKGTYEVGRPQ
      
    Bibliography
    No article yet recorded