Gene ML1371
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable Cytidylate kinase Cmk (CMP kinase) (Cytidine monophosphate kinase) (CK) |
| Comments | ML1371, len: 223 aa. Probable cmk, Cytidylate kinase (EC 2.7.4.14). Highly similar to several cytidylate kinases including: Bacillus subtilis SW:KCY_BACSU (P38493) (224 aa), Fasta scores: E(): 1.9e-28, 42.7% identity in 218 aa overlap and Mycobacterium tuberculosis Rv1712 TR:O33211 (EMBL:Z98268) (230 aa), Fasta scores: E(): 0, 74.8% identity in 222 aa overlap. Contains Pfam match to entry PF02224 Cytidylate_kin, Cytidylate kinase. Contains PS00017 ATP/GTP-binding site motif A (P-loop). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1631209 | 1631880 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1371|cmk
VTDIVVAIDGPAGTGKSSVSRGLARELGARYLDTGAMYRMMTLAVLRAGIDPADAAAIGESVWKVQMLSDHDRYFLGGEDVSSEIRTEEVTQAVSAVSAIPAVRVRLVDLQRQMAEGRGSVVVEGRDIGTVVLPDAPVKIFLTASPETRARRRNDQNVASGSADDYDRVLAEVRRRDHLDSTRAVSPLYVAQDAMIVDTSKMAEAEVIAHLMDLVKQRSGAVW
Bibliography
No article yet recorded