Gene ML1391c
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | conserved hypothetical protein |
Comments | ML1391c, len: 232 aa. Conserved hypothetical protein. Similar to several including: Streptomyces coelicolor putative hydrolase TR:Q9Z505 (EMBL:AL035591) (218 aa), Fasta scores: E(): 0, 50.9% identity in 224 aa overlap and in parts to Rhodopseudomonas blastica probable hydroxyacylglutathione hydrolase SW:GLO2_RHOBL (P05446) (255 aa), Fasta scores: E(): 2.4e-08, 37.9% identity in 145 aa overlap. Also similar to Mycobacterium tuberculosis hypothetical protein Rv1637c TR:O06154 (EMBL:Z95554) (264 aa), Fasta scores: E(): 0, 84.0% identity in 231 aa overlap. Contains Pfam match to entry PF00753 lactamase_B, Metallo-beta-lactamase superfamily. |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1667505 | 1668203 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1391c|ML1391c MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSATGETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATGAPTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALALDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDVYADTTAIYPGHGDDTVLGAERPSLAEWRERGW
Bibliography
No article yet recorded