Gene ML1396
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Probable 50S ribosomal protein L20 RplT |
Comments | ML1396, len: 129 aa. Probable rplT, 50S ribosomal protein L20. Highly similar to many 50s ribosomal L20 proteins, including: Escherichia coli SW:RL20_ECOLI (P02421) (117 aa), Fasta scores: E(): 1.9e-23, 57.8% identity in 116 aa overlap and Mycobacterium tuberculosis Rv1643 SW:RL20_MYCTU (P94977) (129 aa), Fasta scores: E(): 0, 90.7% identity in 129 aa overlap. Contains Pfam match to entry PF00453 Ribosomal_L20, Ribosomal protein L20. Contains PS00937 Ribosomal protein L20 signature. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1676667 | 1677056 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1396|rplT MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDRRARKGEFRKLWISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAISDPAAFTALVEVARSGLPEDVNVPSGEAA
Bibliography
No article yet recorded