Gene ML1408
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable Acetylglutamate kinase ArgB (NAG kinase) (N-acetyl-L-glutamate 5-phosphotransferase ) |
| Comments | ML1408, len: 301 aa. Probable argB, Acetylglutamate kinase (EC 2.7.2.8). Highly similar to many acetylglutamate kinases involved in arginine biosynthesis, including: Corynebacterium glutamicum SW:ARGB_CORGL (Q59281) (294 aa), Fasta scores: E(): 0, 64.1% identity in 270 aa overlap and Mycobacterium tuberculosis Rv1654 SW:ARGB_MYCTU (P94989) (294 aa), Fasta scores: E(): 0, 87.5% identity in 288 aa overlap. Contains Pfam match to entry PF01960 ArgJ, ArgJ family. Contains Pfam match to entry PF00696 aakinase, Amino acid kinase family. Belongs to the acetylglutamate kinase family. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1689936 | 1690841 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1408|argB
VTVLMNRTGDDETLSTQVKAEVLAEALPWLKQLHGKVVVVKYSGNAMTDDMLRRAFAADMAFLRNCGIHPVVVHGGGPQITAMLRRLGIADDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAHGPYAVGITGEDAQLFTAGRRSATVDGMATDIGLVGDVDQVNIAAVLDLISAHRIPVVSTLAPDRDGVVHNINADTAAAALAETLGAEKLLMLTNVEGLYTRWPERDSLVNEIDSAALAQLLPTLEAGMIPKVEACLRAVTGGVPSAHVIDGRVKHCVLVELLTNEGTGTKVVSA
Bibliography
No article yet recorded