Gene ML1413
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable Argininosuccinate lyase ArgH |
| Comments | ML1413, len: 470 aa. Probable argH, Argininosuccinate lyase (EC 4.3.2.1). Highly similar to many argininosuccinate lyases involved in arginine biosynthesis, including: Escherichia coli SW:ARLY_ECOLI (P11447) (172 aa), BlastP Expect 9.3 and Mycobacterium tuberculosis SW:ARLY_MYCTU (P94994) (470 aa), Fasta scores: E(): 0, 88.1% identity in 470 aa overlap. Contains Pfam match to entry PF00206 lyase_1, Lyase. Contains PS00017 ATP/GTP-binding site motif A (P-loop). Contains PS00163 Fumarate lyases signature. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1694888 | 1696300 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1413|argH
MSTNQGSLWGGRFAAGPSEALVALSKSTHFDWVLAPYDITASRAHTKMLFRAGLLNEEQRDGLLAGLDNLAEDVADGSFLPLVTDEDVHAALERGLIDRVGPDLGGRLRAGRSRNDQVATLFRMWLRDAVRRVAAGALEVVDALANQAAEHSSTIMPGKTHLQSAQPILLAHHLLAHAHPLLRDVGRIVDFDKRAAVSPYGSGALAGSSLGLDPDAMAQDLGFPAAADNSVDATAARDFAAEAAFVFAMIAVDLSRLAEDIILWSSTEFGYARLHDSWSTGSSIMPQKKNPDIAELARGKSGRLIGNLAGLLATLKAQPLAYNRDLQEDKEPVFDSVAQLELLLPAMAGLVASLTFNVERMAALAPAGYTLATDIAEWLVRQGVPFRSAHEAAGTAVRVAEGRGVGLEELTDDELAAISANLTPQVREVLTVEGSVSSRAARGGTAPSQAAKQLTVVRANANQLRQLLMR
Bibliography
No article yet recorded