Gene ML1413 
in Mycobacterium leprae TN
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | Probable Argininosuccinate lyase ArgH | 
| Comments | ML1413, len: 470 aa. Probable argH, Argininosuccinate lyase (EC 4.3.2.1). Highly similar to many argininosuccinate lyases involved in arginine biosynthesis, including: Escherichia coli SW:ARLY_ECOLI (P11447) (172 aa), BlastP Expect 9.3 and Mycobacterium tuberculosis SW:ARLY_MYCTU (P94994) (470 aa), Fasta scores: E(): 0, 88.1% identity in 470 aa overlap. Contains Pfam match to entry PF00206 lyase_1, Lyase. Contains PS00017 ATP/GTP-binding site motif A (P-loop). Contains PS00163 Fumarate lyases signature. | 
| Functional category | Intermediary metabolism and respiration | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 1694888 | 1696300 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium leprae TN|ML1413|argH
MSTNQGSLWGGRFAAGPSEALVALSKSTHFDWVLAPYDITASRAHTKMLFRAGLLNEEQRDGLLAGLDNLAEDVADGSFLPLVTDEDVHAALERGLIDRVGPDLGGRLRAGRSRNDQVATLFRMWLRDAVRRVAAGALEVVDALANQAAEHSSTIMPGKTHLQSAQPILLAHHLLAHAHPLLRDVGRIVDFDKRAAVSPYGSGALAGSSLGLDPDAMAQDLGFPAAADNSVDATAARDFAAEAAFVFAMIAVDLSRLAEDIILWSSTEFGYARLHDSWSTGSSIMPQKKNPDIAELARGKSGRLIGNLAGLLATLKAQPLAYNRDLQEDKEPVFDSVAQLELLLPAMAGLVASLTFNVERMAALAPAGYTLATDIAEWLVRQGVPFRSAHEAAGTAVRVAEGRGVGLEELTDDELAAISANLTPQVREVLTVEGSVSSRAARGGTAPSQAAKQLTVVRANANQLRQLLMR
      
    Bibliography
    No article yet recorded