Gene ML1418c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1418c, len: 182 aa. Conserved hypothetical protein. Highly similar to several proteins of undefined function including: Mycobacterium tuberculosis Rv1732c TR:P71990 (EMBL:Z81360) (182 aa), Fasta scores: E(): 0, 86.3% identity in 182 aa overlap and Synechocystis sp. TR:P73178 (EMBL:D90904) (194 aa), Fasta scores: E(): 0, 52.5% identity in 179 aa overlap. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1700700 | 1701248 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1418c|ML1418c
MAIESTMPALGTPAPSFMLFEPASGAMISLDELTGRALVVTFICNHCPYVQHVAAGLAILGRDLADQGVAIVGISSNDVITYPQDGPDQMVAEARRHGWTFPYLYDETQAVARAFAASCTPDTFVFDGERRLVYRGQLDDSRPNNNLPVTAADVRAAVDAVLARRPVDSDQRPSIGCGIKWR
Bibliography
No article yet recorded