Gene ML1427c
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Probable sugar-binding lipoprotein |
Comments | ML1427c, len: 445 aa. Probable sugar-binding lipoprotein. Similar to several putative ABC_transport proteins e.g. Mycobacterium tuberculosis lipoprotein component of sugar transport system Rv2041c TR:O53485 (EMBL:AL021899) (439 aa), Fasta scores: E(): 0, 77.4% identity in 446 aa overlap. Contains a possible N-terminal signal sequence and an appropriately positioned Prokaryotic membrane lipoprotein lipid attachment site. Contains Pfam match to entry PF01547 SBP_bacterial_1, Bacterial extracellular solute-binding protein. Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site. |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1714437 | 1715774 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1427c|ML1427c MHGKLFGRRSLLRGAGALTAAALAPGAVGCSSDDDALTFFFAANPEETNARMRIVGEFQRDHPDIKVRAVLSGPGVMQQLSTFCAGGKCPDVLMAWDLTYAELADRGVLLDLNTLLGQDKAFAAELKSDSIEPLYETFTFNGGQYAFPEQWSGNYLFYNKQLFTNAGVQPPPCTWEQPWSFTEFLDTARALTKRDSSGRVTQWGFVNTWLSYYTAGLFALNNGVPWSNPRMNPTHLNFDDDAFIEAVQFYCDLTNKYQVAPDASEQQWMATADLFSLGKAAIALGGHWRYQTFMRAEGLDFDVTSLPIGPSAGTVPATRSGACSDIGATGLAIAASSSRKEQAWEFVKFATGPAGQALIGESCLFVPVLQSAIYSTGFAKAHNRVANLAVLTGGPVHSAGLPITPAWEKINALMDRNFGPVLRGVRPATSLAGLARAVDEVLNSP
Bibliography
No article yet recorded