Gene ML1494c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved transmembrane protein |
| Comments | ML1494c, len: 117 aa. Probable integral membrane protein. Highly similar to Mycobacterium tuberculosis hypothetical protein Rv1171 TR:O50427 (EMBL:AL010186) (146 aa), Fasta scores: E(): 7.4e-24, 62.2% identity in 111 aa overlap. Contains possible membrane spanning hydrophobic domains. |
| Functional category | Cell wall and cell processes, Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1801374 | 1801727 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1494c|ML1494c
MRIVVLVLFAADGVLSAVVGAMLMPLYIGSVPFPISGLISGLVNAVLVWAARLWTRSPWLVALPLWVWLLTVGLLSLGGPGVDVVSGQSVMASGALWLILLGVSPPACVLWRCNRYG
Bibliography
No article yet recorded