Gene ML1508c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1508c, len: 163 aa. Conserved hypothetical protein. Highly similar to several proteins of undefined function including M. tuberculosis Rv1155 TR:O06553 (EMBL:Z95584) (147 aa), Fasta scores: E(): 0, 87.8% identity in 147 aa overlap and Streptomyces coelicolor TR:Q9XAG1 (EMBL:AL079356) (144 aa), Fasta scores: E(): 5.6e-25, 54.3% identity in 140 aa overlap. |
| Functional category | Conserved hypotheticals, Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1819561 | 1820052 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1508c|ML1508c
MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLSNVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEGTAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTLPILHVYGLPPGIR
Bibliography
No article yet recorded