Gene ML1557c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1557c, len: 106 aa. Conserved hypothetical protein. Highly similar to several proteins of undefined function including: Mycobacterium tuberculosis Rv2840c TR:P71612 (EMBL:Z81331) (99 aa), Fasta scores: E(): 1.7e-30, 81.3% identity in 96 aa overlap. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1883022 | 1883342 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1557c|ML1557c
VRTCVGCRKRELAVELLRVVAPSTGKGSYAVIVDTASSLSGRGAWLHPDMQCVQQAIRRRAFTGALRIAGSPDTSAVVEHIEFLSELDRPGNRTGSKEHEHTVKSR
Bibliography
No article yet recorded