Gene ML1560
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1560, len: 178 aa. Conserved hypothetical protein. Highly similar to Mycobacterium tuberculosis hypothetical protein Rv2843 TR:O05816 (EMBL:Z95207) (181 aa), Fasta scores: E(): 2e-31, 70.2% identity in 168 aa overlap. |
| Functional category | Conserved hypotheticals, Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1885245 | 1885781 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1560|ML1560
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPLDQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATGKLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASGYRAGLLASIAASCTASYTVALVSGGPSI
Bibliography
No article yet recorded