Gene ML1561
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1561, len: 165 aa. Conserved hypothetical protein. Highly similar to proteins of unknown function from Streptomyces coelicolor TR:CAB91137 (EMBL:AL355913) (167 aa), Fasta scores: E(): 1.4e-07, 35.8% identity in 137 aa overlap and Mycobacterium tuberculosis Rv2844 SW:O05815 (162 aa), fasta scores: E(): 6.2e-46, (71.515% identity in 165 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1885778 | 1886275 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1561|ML1561
MTSIEPSAPTPVATPKRTPVSQDSDNAGLSEALVVEHSTIYGYGIVLALSPPNANSLVVDALIQHRQRRDDIIVMLTARRVSPPVAASGYQLPMLVGSAADAARLAVRMENDGATAWRAVAEHAETADDRTFAAMALAQSAVMAARWNKMLGAWPITTTFPGSNE
Bibliography
No article yet recorded