Gene ML1617c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1617c, len: 80 aa. Conserved hypothetical protein. Highly similar to many proteins of undefined function e.g. Mycobacterium tuberculosis Rv2908c SW:YT08_MYCTU (Q10826) (80 aa), Fasta scores: E(): 6.5e-28, 93.8% identity in 80 aa overlap. Contains Pfam match to entry PF00013 KH-domain, KH domain. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1940003 | 1940245 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1617c|ML1617c
MSTVVVDAVEHVVRGIVDNPDDVRVDLVISRRGRTVEVHVHPDDLGKVIGRGGRTATALRKLVAGIGGRGIRVDVVDTDQ
Bibliography
No article yet recorded