Gene ML1783c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible transcriptional regulatory protein |
| Comments | ML1783c, len: 322 aa. Possible transcriptional regulatory protein. Similar to M. tuberculosis Rv2258c TR:O53532 (EMBL:AL021925) (353 aa), Fasta scores: E(): 0, 65.2% identity in 273 aa overlap but shorter at N-terminus and frameshifted near C-terminus. Also similar to some C. elegans proteins e.g. TR:O01593 (EMBL:U97004) (365 aa), Fasta scores: E(): 7.5e-17, 25.1% identity in 303 aa overlap. Contains possible HTH motif at aa 7-28 (+3.24 SD). Contains a probable helix-turn-helix motif at aa 7-28 (Score 1191, SD +3.24) |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2159152 | 2160120 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1783c|ML1783c
MVGLSLVTSTQIAYVAGLNERYVREWLGDMTTGHVVDYYAETGTYSLSVHRVAVLVWATGTNNLASVAQFIPLFSGFEQQFIGGFCDDVGGPYSEFPRFYSLMAEMSGAMFDAAFVDVVLPLANGLPERLRSGAGVADFDCGSGHVVNVLVRAFPASWFIGIDFSNEAVAIHTAEEDRLGLGTVTFESHNLARLDKAAAYDVITVFDASHDHAQPVRVLENIYQALRPGDVLLMASIKVSSQLEDNVDVLMSIYLYTASLMHCMTVSLALQGAPDWMRCGEGGWPPRCSATRDWTTCGWSISSPTRSTTTYIYIATKLPRLT
Bibliography
No article yet recorded