Gene ML1791c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1791c, len: 125 aa. Conserved hypothetical protein. Similar to M. tuberculosis hypothetical protein Rv1976c TR:O53977 (EMBL:AL022073) (135 aa), Fasta scores: E(): 3.5e-28, 65.3% identity in 124 aa overlap, and to Streptomyces coelicolor hypothetical protein SC1C3.03C TR:O69845 (EMBL:AL023702) (125 aa), Fasta scores: E(): 4.3e-06, 36.6% identity in 112 aa overlap. Note start changed since original submission. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2165627 | 2166004 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1791c|ML1791c
VRWIVDAMNVIGTRPDCWWKDRRGAMVRLVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEIVRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
Bibliography
No article yet recorded