Gene ML1795
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | 18 KDA antigen Hsp18 (HSP 16.7) |
Comments | ML1795, len: 148 aa. hsp18, 18 KDA antigen. Highly similar to other mycobacterial antigens e.g. 18K1_MYCIT|P46730 18 kDa antigen 1 from Mycobacterium intracellulare (149 aa), Fasta scores: E(): 0, (78.7% identity in 150 aa overlap), and small heat shock proteins e.g. HS18_STRAL|Q53595 hsp18 from Streptomyces albus (143 aa), Fasta scores: E(): 4.1e-26, (55.0% identity in 140 aa overlap). Previously sequenced as 18KD_MYCLE|P12809 (148 aa), Fasta scores: E(): 0, 100.0% identity in 148 aa overlap. Contains Pfam match to entry PF00011 HSP20, Hsp20/alpha crystallin family. Belongs to the small heat shock protein (HSP20) family. |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2174304 | 2174750 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1795|hsp18 MLMRTDPFRELDRFAEQVLGTSARPAVMPMDAWREGEEFVVEFDLPGIKADSLDIDIERNVVTVRAERPGVDPDREMLAAERPRGVFNRQLVLGENLDTERILASYQEGVLKLSIPVAERAKPRKISVDRGNNGHQTINKTAHEIIDA
Bibliography
No article yet recorded