Gene ML1911A
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1911A, len: 71 aa. Conserved hypothetical protein. Orthologous to M. tuberculosis Rv0634A but may be pseudogene as Rv0634A is predicted to be 13 aa longer. Also similar to M. tuberculosis Rv1560, sp|Q10771|YF60_MYCTU HYPOTHETICAL 8.2 KDA PROTEIN Rv1560 (72 aa) E(): 0.0025; 47.500% identity in 40 aa overlap |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2295163 | 2295378 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1911A|ML1911A
MLKKVEIEVDDDLVQEVIRRYGLLGRREAVHLALKALLGEPGVGGLSEQDPEYDEFSNPDAWRTRRSSDTG
Bibliography
No article yet recorded