Gene ML1922 (TB11.2)
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein TB11.2 homolog |
| Comments | ML1922, len: 105 aa. Conserved hypothetical protein. Similar to M. tuberculosis conserved hypothetical protein Rv3592 TR:O06156 (EMBL:Z95555) (105 aa), Fasta scores: E(): 0, 84.6% identity in 104 aa overlap, and to others e.g. Bacillus subtilis hypothetical protein SW:YHGC_BACSU (L10630) (166 aa), Fasta scores: E(): 5.2e-06, 40.8% identity in 71 aa overlap. |
| Functional category | Conserved hypotheticals, Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2305210 | 2305527 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1922|ML1922
MPVVKINAIEVSTDVGLELERRFAHRAHAVENSPGFLGFQLLRPIKGENRYFVVTHWESDEAFQAWANGPAIEAHAGHSANPVAAGSSLLEFEVVLDVATTSQTN
Bibliography
No article yet recorded