Gene ML1926c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | putative tuberculin related peptide (AT103) |
| Comments | ML1926c, len: 167 aa. Putative tuberculin related peptide (AT103). Similar to M. tuberculosis tuberculin related peptide (AT103) Rv0431 TR:P96277 (EMBL:Z84724) (164 aa), Fasta scores: E(): 1.6e-32, 67.5% identity in 163 aa overlap and TR:O69619 (EMBL:D00815) (172 aa), Fasta scores: E(): 1.5e-32, 67.1% identity in 164 aa overlap. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2311565 | 2312068 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1926c|ML1926c
LVDTVGLVNKCVPDSSGLPLRAMVMVLLFLGVIFLLLGWQALGSSGNSDDYSALPMSSMPNTPTTPAATSTSSTSAANQAEVRVYNISSKEGIAARTRDQLTTAGFKVTEVDNLVVSDVSATTVYYSDAEGEYATADAVGQKLGAPVEPRIAAITNQPPGVIVLVTS
Bibliography
No article yet recorded