Gene ML1927c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1927c, len: 102 aa. Conserved hypothetical protein. Similar to M. tuberculosis hypothetical protein Rv0430 TR:P96276 (EMBL:Z84724) (102 aa), Fasta scores: E(): 0, 93.1% identity in 102 aa overlap, and to Streptomyces coelicolor hypothetical protein SCD95A.20 TR:CAB93047 (EMBL:AL357432) (84 aa), Fasta scores: E(): 4.1e-11, 52.8% identity in 72 aa overlap. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2312099 | 2312407 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1927c|ML1927c
MDGAMARAHRAGDDVEIVDGLTRREHDILAFERQWWKFAGVKEEAIKELFSMSATRYYQVLNALVDRPEALAVDPMLVKRLRRLRASRQKARAARRLGFEVT
Bibliography
No article yet recorded