Gene ML2020
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML2020, len: 304 aa. Conserved hypothetical protein. Similar to M. tuberculosis conserved hypothetical protein Rv1896c TR:O07736 (EMBL:Z97193) (303 aa), Fasta scores: E(): 0, 78.0% identity in 300 aa overlap, and to many other M. tuberculosis hypothetical proteins e.g. Rv3399 SW:YX99_MYCTU (Z77165) (348 aa), Fasta scores: E(): 0, 41.4% identity in 304 aa overlap. Also similar to ML2640 and ML2539 from M. leprae. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2411322 | 2412236 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2020|ML2020
LMAATPEFGSLRSDDDHWDIVSSVGYTALLVAGWRALHAVGPQPLVRDEYAKYFITASRDPYLMNLLANPGTSLNETAFPRLYGVQTRFFDDFFSSAGDTGIRQAVIVAAGLDSRAYRLKWPNGATVFEIDLPKVLEFKARVLAEQGAIPNAGRSEVAADLRADWPRALKAAGFDPQRSSAWSVEGLLPYLTNDAQSALFTRIGELCAPGSRIAVGALGSRLDRKQLAALEATHPGVNISGDVDFSALTYEPKTDSAQWLAAHGWAVEPVRNTLELQTSYGMTPPDVDVQMDSFMHSQYITATR
Bibliography
No article yet recorded