Gene ML2031 
in Mycobacterium leprae TN
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | conserved hypothetical protein | 
| Comments | ML2031, len: 151 aa. Conserved hypothetical protein. Similar to Mycobacterium tuberculosis hypothetical protein TR:O07748 (EMBL:Z97193) fasta scores: E(): 0, 76.2% in 151 aa, and to Streptomyces actuosus NSH-OrfB TR:P72384 (EMBL:U75434) fasta scores: E(): 2.5e-08, 34.4% in 125 aa. | 
| Functional category | Conserved hypotheticals | 
| Mutant | Check for mutants available at TARGET website  | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 2421158 | 2421613 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium leprae TN|ML2031|ML2031
MEGSVTVHMAAPADKVWNLIADVRNTGRFSPETFEAEWLDDVTGPALNAKFRGHVRRNEIGPVYWTTCKVTACEPGREFGFTVLLGNKPVNNWHYRLVTSGDGTYVTESFRFNRSPLLTVYWLLGGFLRKRRNIRDMTKTLRRIKDVVEAE
      
    Bibliography
    No article yet recorded