Gene ML2031
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML2031, len: 151 aa. Conserved hypothetical protein. Similar to Mycobacterium tuberculosis hypothetical protein TR:O07748 (EMBL:Z97193) fasta scores: E(): 0, 76.2% in 151 aa, and to Streptomyces actuosus NSH-OrfB TR:P72384 (EMBL:U75434) fasta scores: E(): 2.5e-08, 34.4% in 125 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2421158 | 2421613 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2031|ML2031
MEGSVTVHMAAPADKVWNLIADVRNTGRFSPETFEAEWLDDVTGPALNAKFRGHVRRNEIGPVYWTTCKVTACEPGREFGFTVLLGNKPVNNWHYRLVTSGDGTYVTESFRFNRSPLLTVYWLLGGFLRKRRNIRDMTKTLRRIKDVVEAE
Bibliography
No article yet recorded