Gene ML2055c (modD)
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | ALANINE AND PROLINE RICH SECRETED PROTEIN APA (FIBRONECTIN ATTACHMENT PROTEIN) (Immunogenic protein MPT32) (Antigen MPT-32) (45-kDa glycoprotein) (45/47 kDa antigen) |
| Comments | ML2055c, len: 287 aa. Probable apa (alternate gene names: mpt32, modD), Ala-, Pro-rich 45/47 kDa secreted protein. Previously sequenced Mycobacterium leprae TR:Q9R5V6 fasta scores: E(): 0, 100.0% in 287 aa. The product of this CDS has also been shown to be highly immunogenic, Mycobacterium leprae molybdate uptake protein SW:MODD_MYCLE (P46842) fasta scores: E(): 0, 99.3% in 287 aa, and highly similar to several proteins involved in the uptake of molybdenum in other mycobacteria e.g. Mycobacterium tuberculosis molybdate uptake secreted protein precursor Rv1860 SW:MODD_MYCTU (Q50906; O08062) fasta scores: E(): 0, 66.8% in 298 aa. Contains a possible N-terminal signal sequence. Previously known as modD. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2442648 | 2443511 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2055c|apa
MNQVDLDSTHRKGLWAILAIAVVASASAFTMPLPAAANADPAPLPPSTATAAPSPAQEIITPLPGAPVSSEAQPGDPNAPSLDPNAPYPLAVDPNAGRITNAVGGFSFVLPAGWVESEASHLDYGSVLLSKAIEQPPVLGQPTVVATDTRIVLGRLDQKLYASAEADNIKAAVRLGSDMGEFYLPYPGTRINQETIPLHANGIAGSASYYEVKFSDPNKPIGQICTSVVGSPAASTPDVGPSQRWFVVWLGTSNNPVDKGAAKELAESIRSEMAPIPASVSAPAPVG
Bibliography
No article yet recorded
