Gene ML2073c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML2073c, len: 231 aa. Conserved hypothetical protein. Similar to Mycobacterium tuberculosis hypothetical 24.0 kda protein Rv1830 SW:YI30_MYCTU (Q50603) fasta scores: E(): 0, 90.0% in 231 aa, and to Streptomyces coelicolor hypothetical 19.1 kda protein TR:CAB88877 (EMBL:AL353861) fasta scores: E(): 3.7e-30, 64.8% in 145 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2466452 | 2467147 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2073c|ML2073c
MTHLVTRARSARGNTVSEQPRQGQLDLADYRDTPTATTHGDIGLNGPTAVSGPAQPGLFPDDSVPDELVGYRGPSACQIAGITYRQLDYWARTSLVVPSIRGAAGSGSQRLYSFKDILVLKIVKRLLDTGISLHNIRVAVDHLRQRGVQDLANITLFSDGTTVYECTSAEEVVDLLQGGQGVFGIAVSGAMRELTGVIDDFRGERADGGESIAAPEDELASRRKHRDRKIG
Bibliography
No article yet recorded