Gene ML2088c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | putative cytochrome p450 |
| Comments | ML2088c, len: 434 aa. Putative cytochrome p450. Similar to several e.g. Q9X8Q3|AL049754 Streptomyces coelicolor putative cytochrome p-450 hydroxylase (411 aa), fasta scores: E(): 0, (37.4% in 401 aa), and to Rv1880c|YI80_MYCTU|O08464 Mycobacterium tuberculosis putative cytochrome p450 (438 aa), fasta scores: E(): 0, (38.0% in 416 aa). And to BIOI_BACSU|P53554 Bacillus subtilis biotin biosynthesis; cytochrome p450-like enzyme (395 aa), fasta scores: E(): 0, (37.1% in 383 aa). Contains Pfam match to entry PF00067 p450, Cytochrome P450. BELONGS TO THE CYTOCHROME P450 FAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2481551 | 2482855 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2088c|ML2088c
MRTCVPTRTCVYAFIEYLSHNRPMGTNPPSLVEAQMLLLRLIDPGTRADPFPVYRALIDYGPMQLPGMPLTVFSSFSDCDEALRHPLSASDRLKATLAQQAIAAGAEPRPFYASSFMFLDPPDHTRLRKLVSKAFAPKVVQALEGDIAALVDSLLDKGAAAGQFDVIADLAFPLAVAVICRLLGVPYEDAPEFGRVSALLVQSVDPFITITGEPPEATEERLRAGVWLRDYLEQLVKCRRGTPGEDLISRLIELDESGDQLTEEEIIATCGLLLVAGHETTVNLIANAVLAMLRNPSQWKALSSNPQRAPLVVEETLRYDPAIHLIGRVAAKDMTIGQTTLTEGDTMVLLLAAANRDPAVYSRPDEFDPDRPSSRHLAFAVGSHFCLGAALARLEATVTLSAISARFPQVQLAGELVYKPNVAMRGMSALPVQV
Bibliography
No article yet recorded
