Gene ML2113c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML2113c, len: 181 aa. Conserved hypothetical protein. Similar to Mycobacterium tuberculosis hypothetical 15.8 kda protein Rv0910 TR:O05902 (EMBL:Z95210) fasta scores: E(): 0, 83.9% in 143 aa, and to Mycobacterium tuberculosis hypothetical 15.3 kda protein Rv1546 SW:YF46_MYCTU (Q10780) fasta scores: E(): 1e-19, 38.0% in 142 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2513877 | 2514422 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2113c|ML2113c
VTSRIKRMAKLTGSIDVPLPPNEAWMCASDLARFGEWLTIHRAWRSKLPEVVEKGTVIESYVEVKGMPNRIRWTVVRYKAPEAMTLNGDGVGGVKVKLIAKVSPKDDGSVVSFDVHLGGSALFGPIGMIVAVALRTDIRESLQNFVTAFSRPEPGLIRSRALVVDQHSRAVVEQRSASAGL
Bibliography
No article yet recorded