Gene ML2114c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML2114c, len: 56 aa. Conserved hypothetical protein. Similar to Mycobacterium tuberculosis hypothetical 6.4 kda protein Rv0909 TR:O05901 (EMBL:Z95210) fasta scores: E(): 1.8e-07, 61.9% in 42 aa, and to Streptomyces coelicolor hypothetical 9.9 kda protein TR:O69965 (EMBL:AL022268) fasta scores: E(): 0.038, 41.3% in 46 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2514419 | 2514589 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2114c|ML2114c
VLDKAKDILVQNADKVETVLDKAGEFVDEKAKGKYTDTIYQVAEETKKAASFDTFG
Bibliography
No article yet recorded